Description
LL-37 is studied in experimental models examining its interaction with microbial membranes and host cell signaling pathways associated with innate immune responses. Research interest includes analysis of membrane-binding dynamics, peptide-induced permeability changes, and modulation of signaling pathways involved in inflammatory and immune-related processes. Investigations may also explore its role in chemotactic signaling, receptor interactions, and cellular communication in controlled in vitro and preclinical models. Common laboratory applications include antimicrobial peptide studies, membrane interaction assays, and mechanistic evaluation of peptide-mediated immune signaling.
Overview
LL-37 is a synthetic peptide corresponding to a 37–amino acid fragment derived from the human cathelicidin antimicrobial peptide family. In laboratory settings, it is utilized in controlled research environments to study peptide–membrane interactions and innate immune system signaling. This material is provided strictly for analytical and investigational use in controlled research environments. It is not intended for human or veterinary use. Product descriptions are presented for educational and catalog reference purposes only.
Chemical Makeup
Amino Acid Sequence: [LL-37, 37 aa]
Molecular Formula: C205H340N60O53
Molecular Weight: 4493.28 g/mol
CAS Number: 597562-32-8
Reviews
There are no reviews yet.