Description
IGF-1 LR3 is studied in laboratory models for its interaction with IGF-1 receptor (IGF-1R) signaling pathways, which are associated with cellular proliferation, differentiation, and survival mechanisms. Due to its structural modifications, research often examines its prolonged receptor binding dynamics and downstream signaling effects compared to native IGF-1. Common areas of investigation include intracellular signaling cascades such as PI3K/AKT and MAPK pathways, protein synthesis regulation, and in vitro models evaluating growth factor-mediated cellular responses.
Overview
IGF-1 LR3 is a synthetic analog of insulin-like growth factor-1 (IGF-1), modified to extend its stability and activity in controlled laboratory environments. This peptide is commonly utilized in research settings focused on cellular growth factor signaling and receptor interaction studies. This material is provided strictly for analytical and investigational use in controlled research environments. It is not intended for human or veterinary use. Product descriptions are presented for educational and catalog reference purposes only.
Chemical Makeup
Amino Acid Sequence: GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQT
Molecular Formula: C400H625N111O115S9
Molecular Weight: 9112.58 g/mol
CAS Number: 946870-92-4
